Lineage for d1dqwa_ (1dqw A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1566369Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1566456Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 1566501Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51380] (2 PDB entries)
  8. 1566502Domain d1dqwa_: 1dqw A: [28551]

Details for d1dqwa_

PDB Entry: 1dqw (more details), 2.1 Å

PDB Description: crystal structure of orotidine 5'-phosphate decarboxylase
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1dqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqwa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhkatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
hvdiltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditn
ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslstgeytkgtvdiaksdkdfvi
gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
grdakvegeryrkagweaylrrcgqqd

SCOPe Domain Coordinates for d1dqwa_:

Click to download the PDB-style file with coordinates for d1dqwa_.
(The format of our PDB-style files is described here.)

Timeline for d1dqwa_: