Lineage for d1dlga_ (1dlg A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031026Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1031036Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 1031046Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
  6. 1031087Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (2 species)
  7. 1031088Species Enterobacter cloacae [TaxId:550] [55212] (9 PDB entries)
    Uniprot P33038
  8. 1031094Domain d1dlga_: 1dlg A: [39580]
    complexed with hai, po4

Details for d1dlga_

PDB Entry: 1dlg (more details), 1.9 Å

PDB Description: crystal structure of the c115s enterobacter cloacae mura in the un- liganded state
PDB Compounds: (A:) udp-n-acetylglucosamine enolpyruvyl transferase mura

SCOPe Domain Sequences for d1dlga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlga_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggsaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOPe Domain Coordinates for d1dlga_:

Click to download the PDB-style file with coordinates for d1dlga_.
(The format of our PDB-style files is described here.)

Timeline for d1dlga_: