Lineage for d1dlga_ (1dlg A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33329Fold d.68: IF3-like [55199] (2 superfamilies)
  4. 33337Superfamily d.68.2: EPT/RTPC-like [55205] (2 families) (S)
  5. 33347Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins)
  6. 33353Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (2 species)
  7. 33354Species Enterobacter cloacae [TaxId:550] [55212] (5 PDB entries)
  8. 33359Domain d1dlga_: 1dlg A: [39580]

Details for d1dlga_

PDB Entry: 1dlg (more details), 1.9 Å

PDB Description: crystal structure of the c115s enterobacter cloacae mura in the un- liganded state

SCOP Domain Sequences for d1dlga_:

Sequence, based on SEQRES records: (download)

>d1dlga_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverxgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggsaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

Sequence, based on observed residues (ATOM records): (download)

>d1dlga_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkvergsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggsaigarp
vdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtti
ienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflva
aaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphpa
fptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekls
gaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOP Domain Coordinates for d1dlga_:

Click to download the PDB-style file with coordinates for d1dlga_.
(The format of our PDB-style files is described here.)

Timeline for d1dlga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dlgb_