Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.3: SirA-like [64307] (1 family) |
Family d.68.3.3: SirA-like [88852] (5 proteins) predicted redox protein, regulator of disulfide bond formation |
Protein SirA [64309] (1 species) implicated in cell division |
Species Escherichia coli [TaxId:562] [64310] (1 PDB entry) formerly hypothetical protein YhhP |
Domain d1dcja_: 1dcj A: [59115] structural genomics |
PDB Entry: 1dcj (more details)
SCOPe Domain Sequences for d1dcja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcja_ d.68.3.3 (A:) SirA {Escherichia coli [TaxId: 562]} mtdlfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfme helvaketdglpyrylirkgg
Timeline for d1dcja_: