Lineage for d1dcja_ (1dcj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957373Superfamily d.68.3: SirA-like [64307] (1 family) (S)
  5. 2957374Family d.68.3.3: SirA-like [88852] (5 proteins)
    predicted redox protein, regulator of disulfide bond formation
  6. 2957384Protein SirA [64309] (1 species)
    implicated in cell division
  7. 2957385Species Escherichia coli [TaxId:562] [64310] (1 PDB entry)
    formerly hypothetical protein YhhP
  8. 2957386Domain d1dcja_: 1dcj A: [59115]
    structural genomics

Details for d1dcja_

PDB Entry: 1dcj (more details)

PDB Description: solution structure of yhhp, a novel escherichia coli protein implicated in the cell division
PDB Compounds: (A:) yhhp protein

SCOPe Domain Sequences for d1dcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcja_ d.68.3.3 (A:) SirA {Escherichia coli [TaxId: 562]}
mtdlfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfme
helvaketdglpyrylirkgg

SCOPe Domain Coordinates for d1dcja_:

Click to download the PDB-style file with coordinates for d1dcja_.
(The format of our PDB-style files is described here.)

Timeline for d1dcja_: