Lineage for d1czan3 (1cza N:466-670)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492087Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 2492109Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 2492110Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries)
  8. 2492113Domain d1czan3: 1cza N:466-670 [33465]
    complexed with adp, g6p, glc; mutant

Details for d1czan3

PDB Entry: 1cza (more details), 1.9 Å

PDB Description: mutant monomer of recombinant human hexokinase type i complexed with glucose, glucose-6-phosphate, and adp
PDB Compounds: (N:) hexokinase type I

SCOPe Domain Sequences for d1czan3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
qhrqieetlahfhltkdmllevkkrmraemelglrkqthnnavvkmlpsfvrrtpdgten
gdflaldlggtnfrvllvkirsgkkrtvemhnkiyaipieimqgtgeelfdhivscisdf
ldymgikgprmplgftfsfpcqqtsldagilitwtkgfkatdcvghdvvtllrdaikrre
efdldvvavvndtvgtmmtcayeep

SCOPe Domain Coordinates for d1czan3:

Click to download the PDB-style file with coordinates for d1czan3.
(The format of our PDB-style files is described here.)

Timeline for d1czan3: