| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.1: Papain-like [54002] (26 proteins) |
| Protein Proline-specific cysteine protease [54013] (1 species) |
| Species Ginger rhizome (Zingiber officinale) [TaxId:94328] [54014] (1 PDB entry) |
| Domain d1cqda_: 1cqd A: [37027] complexed with nag, thj |
PDB Entry: 1cqd (more details), 2.1 Å
SCOPe Domain Sequences for d1cqda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]}
lpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdcttan
hgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshneqs
lqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivkns
wgknwgesgyiraernienpdgkcgitrfasypvkk
Timeline for d1cqda_: