Lineage for d1cqda_ (1cqd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926924Protein Proline-specific cysteine protease [54013] (1 species)
  7. 2926925Species Ginger rhizome (Zingiber officinale) [TaxId:94328] [54014] (1 PDB entry)
  8. 2926926Domain d1cqda_: 1cqd A: [37027]
    complexed with nag, thj

Details for d1cqda_

PDB Entry: 1cqd (more details), 2.1 Å

PDB Description: the 2.1 angstrom structure of a cysteine protease with proline specificity from ginger rhizome, zingiber officinale
PDB Compounds: (A:) protein (protease II)

SCOPe Domain Sequences for d1cqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]}
lpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdcttan
hgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshneqs
lqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivkns
wgknwgesgyiraernienpdgkcgitrfasypvkk

SCOPe Domain Coordinates for d1cqda_:

Click to download the PDB-style file with coordinates for d1cqda_.
(The format of our PDB-style files is described here.)

Timeline for d1cqda_: