PDB entry 1cqd

View 1cqd on RCSB PDB site
Description: the 2.1 angstrom structure of a cysteine protease with proline specificity from ginger rhizome, zingiber officinale
Class: hydrolase
Keywords: cysteine protease, glycoprotein, proline specificity, carbohydrate, papain family, hydrolase
Deposited on 1999-06-15, released 1999-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (protease II)
    Species: Zingiber officinale [TaxId:94328]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cqda_
  • Chain 'B':
    Compound: protein (protease II)
    Species: Zingiber officinale [TaxId:94328]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cqdb_
  • Chain 'C':
    Compound: protein (protease II)
    Species: Zingiber officinale [TaxId:94328]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cqdc_
  • Chain 'D':
    Compound: protein (protease II)
    Species: Zingiber officinale [TaxId:94328]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cqdd_
  • Heterogens: NAG, THJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cqdA (A:)
    ddlpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdctt
    anhgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshne
    qslqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivk
    nswgknwgesgyiraernienpdgkcgitrfasypvkkgtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqdA (A:)
    lpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdcttan
    hgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshneqs
    lqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivkns
    wgknwgesgyiraernienpdgkcgitrfasypvkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cqdB (B:)
    ddlpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdctt
    anhgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshne
    qslqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivk
    nswgknwgesgyiraernienpdgkcgitrfasypvkkgtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqdB (B:)
    lpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdcttan
    hgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshneqs
    lqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivkns
    wgknwgesgyiraernienpdgkcgitrfasypvkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cqdC (C:)
    ddlpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdctt
    anhgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshne
    qslqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivk
    nswgknwgesgyiraernienpdgkcgitrfasypvkkgtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqdC (C:)
    lpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdcttan
    hgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshneqs
    lqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivkns
    wgknwgesgyiraernienpdgkcgitrfasypvkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cqdD (D:)
    ddlpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdctt
    anhgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshne
    qslqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivk
    nswgknwgesgyiraernienpdgkcgitrfasypvkkgtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqdD (D:)
    lpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdcttan
    hgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshneqs
    lqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivkns
    wgknwgesgyiraernienpdgkcgitrfasypvkk