Lineage for d1coza_ (1coz A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.2: Cytidylyltransferase [52394] (2 proteins)
automatically mapped to Pfam PF01467Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species) Species Bacillus subtilis [TaxId:1423] [52396] (2 PDB entries) 
Domain d1coza_: 1coz A: [31598]
complexed with ctp
Details for d1coza_
PDB Entry: 1coz (more details), 2 Å
PDB Description: ctp:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis
PDB Compounds: (A:) protein (glycerol-3-phosphate cytidylyltransferase)SCOPe Domain Sequences for d1coza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]}
mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
kikeei
SCOPe Domain Coordinates for d1coza_:
Click to download the PDB-style file with coordinates for d1coza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1coza_:
- d1coza_ first appeared (with stable ids) in SCOP 1.55
- d1coza_ appears in SCOPe 2.05
- d1coza_ appears in SCOPe 2.07
- d1coza_ appears in the current release, SCOPe 2.08
View in 3D
