Lineage for d1coza_ (1coz A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) 
Superfamily c.26.1: Nucleotidylyl transferase [52374] (3 families) 
Family c.26.1.2: Cytidylyltransferase [52394] (1 protein) Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species) Species Bacillus subtilis [TaxId:1423] [52396] (1 PDB entry) 
Domain d1coza_: 1coz A: [31598]
Details for d1coza_
PDB Entry: 1coz (more details), 2 Å
PDB Description: ctp:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis
SCOP Domain Sequences for d1coza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis}
mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
kikeei
SCOP Domain Coordinates for d1coza_:
Click to download the PDB-style file with coordinates for d1coza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1coza_:
- d1coza_ appears in SCOP 1.57
- d1coza_ appears in the current release, SCOPe 2.08
View in 3D
