Lineage for d1ci4a_ (1ci4 A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.60: SAM domain-like [47768] (16 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) 
contains one classic and one pseudo HhH motifs
automatically mapped to Pfam PF02961Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein) Protein Barrier-to-autointegration factor, BAF [47800] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47801] (7 PDB entries) 
Domain d1ci4a_: 1ci4 A: [17970]
protein/DNA complex
Details for d1ci4a_
PDB Entry: 1ci4 (more details), 1.9 Å
PDB Description: the crystal structure of human barrier-to-autointegration factor (baf)
PDB Compounds: (A:) protein (barrier-to-autointegration factor (baf))SCOPe Domain Sequences for d1ci4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ci4a_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl
SCOPe Domain Coordinates for d1ci4a_:
Click to download the PDB-style file with coordinates for d1ci4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ci4a_:
- d1ci4a_ first appeared (with stable ids) in SCOP 1.55
- d1ci4a_ appears in SCOPe 2.05
- d1ci4a_ appears in SCOPe 2.07
- d1ci4a_ appears in the current release, SCOPe 2.08
View in 3D
