PDB entry 1ci4

View 1ci4 on RCSB PDB site
Description: the crystal structure of human barrier-to-autointegration factor (baf)
Class: DNA binding protein
Keywords: DNA binding protein, retroviral integration, preintegration complex
Deposited on 1999-04-07, released 2000-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (barrier-to-autointegration factor (baf))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75531 (0-88)
      • modified residue (0)
      • modified residue (14)
    Domains in SCOPe 2.06: d1ci4a_
  • Chain 'B':
    Compound: protein (barrier-to-autointegration factor (baf))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75531 (Start-88)
      • modified residue (14)
    Domains in SCOPe 2.06: d1ci4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ci4A (A:)
    mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
    ewlkdtcganakqsrdcfgclrewcdafl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ci4B (B:)
    mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
    ewlkdtcganakqsrdcfgclrewcdafl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ci4B (B:)
    ttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfre
    wlkdtcganakqsrdcfgclrewcdafl