Lineage for d1c9wa_ (1c9w A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568069Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1568070Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1568251Protein CHO reductase [51441] (1 species)
  7. 1568252Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [51442] (1 PDB entry)
  8. 1568253Domain d1c9wa_: 1c9w A: [28699]
    complexed with nap

Details for d1c9wa_

PDB Entry: 1c9w (more details), 2.4 Å

PDB Description: cho reductase with nadp+
PDB Compounds: (A:) cho reductase

SCOPe Domain Sequences for d1c9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9wa_ c.1.7.1 (A:) CHO reductase {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
stfvelstkakmpivglgtwqsppgqvkeavkvaidagyrhidcayayynehevgeaiqe
kikekavrredlfivsklwptcferkllkeafqktltdlkldyldlylihwpqglqpgke
lfpkddqgnvltskitfldawevmeelvdeglvkalgvsnfnhfqierilnkpglkhkpv
tnqvechpyltqeklieychskgitvtaysplgspnrpwakpedpslledpkikeiaakh
kktsaqvlirfhiqrnvvvipksvtparihenfqvfdfqlsdqematilgfnrnwracll
petvnmeeypydaey

SCOPe Domain Coordinates for d1c9wa_:

Click to download the PDB-style file with coordinates for d1c9wa_.
(The format of our PDB-style files is described here.)

Timeline for d1c9wa_: