Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein CHO reductase [51441] (1 species) |
Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [51442] (1 PDB entry) |
Domain d1c9wa_: 1c9w A: [28699] complexed with nap |
PDB Entry: 1c9w (more details), 2.4 Å
SCOPe Domain Sequences for d1c9wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9wa_ c.1.7.1 (A:) CHO reductase {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} stfvelstkakmpivglgtwqsppgqvkeavkvaidagyrhidcayayynehevgeaiqe kikekavrredlfivsklwptcferkllkeafqktltdlkldyldlylihwpqglqpgke lfpkddqgnvltskitfldawevmeelvdeglvkalgvsnfnhfqierilnkpglkhkpv tnqvechpyltqeklieychskgitvtaysplgspnrpwakpedpslledpkikeiaakh kktsaqvlirfhiqrnvvvipksvtparihenfqvfdfqlsdqematilgfnrnwracll petvnmeeypydaey
Timeline for d1c9wa_: