Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries) |
Domain d1c5ha_: 1c5h A: [24311] |
PDB Entry: 1c5h (more details), 1.55 Å
SCOPe Domain Sequences for d1c5ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5ha_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]} astdywqnwtdgggivnavngsggnysvnwsntgdfvvgkgwttgspfrtinynagvwap ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss nvtvw
Timeline for d1c5ha_: