Lineage for d1buea_ (1bue A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013003Protein beta-Lactamase, class A [56606] (16 species)
  7. 3013031Species Enterobacter cloacae, NMC-A carbapenemase [TaxId:550] [56613] (2 PDB entries)
  8. 3013032Domain d1buea_: 1bue A: [42727]

Details for d1buea_

PDB Entry: 1bue (more details), 1.64 Å

PDB Description: nmc-a carbapenemase from enterobacter cloacae
PDB Compounds: (A:) protein (imipenem-hydrolysing beta-lactamase)

SCOPe Domain Sequences for d1buea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buea_ e.3.1.1 (A:) beta-Lactamase, class A {Enterobacter cloacae, NMC-A carbapenemase [TaxId: 550]}
ntkgideiknletdfngrigvyaldtgsgksfsyranerfplcssfkgflaaavlkgsqd
nrlnlnqivnyntrslefhspittkykdngmslgdmaaaalqysdngatniileryiggp
egmtkfmrsigdedfrldrweldlntaipgderdtstpaavakslktlalgnilseheke
tyqtwlkgnttgaarirasvpsdwvvgdktgscgaygtandyavvwpknrapliisvytt
knekeakhedkviaeasriaidnlk

SCOPe Domain Coordinates for d1buea_:

Click to download the PDB-style file with coordinates for d1buea_.
(The format of our PDB-style files is described here.)

Timeline for d1buea_: