PDB entry 1bue

View 1bue on RCSB PDB site
Description: nmc-a carbapenemase from enterobacter cloacae
Class: hydrolase
Keywords: hydrolase, antibiotic resistance, class a carbapenemase
Deposited on 1998-09-03, released 1999-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (imipenem-hydrolysing beta-lactamase)
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1buea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bueA (A:)
ntkgideiknletdfngrigvyaldtgsgksfsyranerfplcssfkgflaaavlkgsqd
nrlnlnqivnyntrslefhspittkykdngmslgdmaaaalqysdngatniileryiggp
egmtkfmrsigdedfrldrweldlntaipgderdtstpaavakslktlalgnilseheke
tyqtwlkgnttgaarirasvpsdwvvgdktgscgaygtandyavvwpknrapliisvytt
knekeakhedkviaeasriaidnlk