Lineage for d1bqqt_ (1bqq T:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.3: TIMP-like [50242] (4 families) 
Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
contains an irregular alpha+beta subdomain in the C-terminal extension
automatically mapped to Pfam PF00965Protein TIMP-2 [50246] (2 species) Species Cow (Bos taurus) [TaxId:9913] [50248] (3 PDB entries) 
Domain d1bqqt_: 1bqq T: [25237]
Other proteins in same PDB: d1bqqm_
complexed with ca, zn
Details for d1bqqt_
PDB Entry: 1bqq (more details), 2.75 Å
PDB Description: crystal structure of the mt1-mmp--timp-2 complex
PDB Compounds: (T:) metalloproteinase inhibitor 2SCOPe Domain Sequences for d1bqqt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqqt_ b.40.3.1 (T:) TIMP-2 {Cow (Bos taurus) [TaxId: 9913]}
cscspvhpqqafcnadivirakavnkkevdsgndiygnpikriqyeikqikmfkgpdqdi
efiytapaaavcgvsldiggkkeyliagkaegngnmhitlcdfivpwdtlsatqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
aapp
SCOPe Domain Coordinates for d1bqqt_:
Click to download the PDB-style file with coordinates for d1bqqt_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bqqt_:
- d1bqqt_ first appeared (with stable ids) in SCOP 1.55
- d1bqqt_ appears in SCOPe 2.07
View in 3D
