Lineage for d1bqqt_ (1bqq T:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789220Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2789221Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
    automatically mapped to Pfam PF00965
  6. 2789236Protein TIMP-2 [50246] (2 species)
  7. 2789237Species Cow (Bos taurus) [TaxId:9913] [50248] (3 PDB entries)
  8. 2789240Domain d1bqqt_: 1bqq T: [25237]
    Other proteins in same PDB: d1bqqm_
    complexed with ca, zn

Details for d1bqqt_

PDB Entry: 1bqq (more details), 2.75 Å

PDB Description: crystal structure of the mt1-mmp--timp-2 complex
PDB Compounds: (T:) metalloproteinase inhibitor 2

SCOPe Domain Sequences for d1bqqt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqqt_ b.40.3.1 (T:) TIMP-2 {Cow (Bos taurus) [TaxId: 9913]}
cscspvhpqqafcnadivirakavnkkevdsgndiygnpikriqyeikqikmfkgpdqdi
efiytapaaavcgvsldiggkkeyliagkaegngnmhitlcdfivpwdtlsatqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
aapp

SCOPe Domain Coordinates for d1bqqt_:

Click to download the PDB-style file with coordinates for d1bqqt_.
(The format of our PDB-style files is described here.)

Timeline for d1bqqt_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bqqm_