SCOPe 2.08: Domain d1bqqm_: 1bqq M:

Lineage for d1bqqm_ (1bqq M:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Membrane-type matrix metalloproteinase (CDMT1-MMP) [55543] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55544] (2 PDB entries)

8. Domain d1bqqm_: 1bqq M: [40406]
   Other proteins in same PDB: d1bqqt_
   complexed with ca, zn

Details for d1bqqm_

PDB Entry: 1bqq, 2.75 Å

PDB Description: crystal structure of the mt1-mmp--timp-2 complex

PDB Compounds: (M:) membrane-type matrix metalloproteinase

SCOPe Domain Sequences for d1bqqm_:

Sequence; same for both SEQRES and ATOM records:

>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]}
iqglkwqhneitfciqnytpkvgeyatyeairkafrvwesatplrfrevpyayireghek
qadimiffaegfhgdstpfdgeggflahayfpgpniggdthfdsaepwtvrnedlngndi
flvavhelghalglehssdpsaimapfyqwmdtenfvlpdddrrgiqqlygges

Timeline for d1bqqm_:

• d1bqqm_ first appeared (with stable ids) in SCOP 1.55
  
• d1bqqm_ appears in SCOPe 2.07