Lineage for d1blua_ (1blu A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1203811Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1203812Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
    contains two 4Fe-4S clusters
  6. 1203813Protein Ferredoxin II [54864] (5 species)
  7. 1203814Species Chromatium vinosum [TaxId:1049] [54869] (1 PDB entry)
  8. 1203815Domain d1blua_: 1blu A: [38948]
    complexed with sf4

Details for d1blua_

PDB Entry: 1blu (more details), 2.1 Å

PDB Description: structure of the 2[4fe-4s] ferredoxin from chromatium vinosum
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1blua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]}
almitdecincdvcepecpngaisqgdetyviepslctecvghyetsqcvevcpvdciik
dpsheetedelrakyeritg

SCOPe Domain Coordinates for d1blua_:

Click to download the PDB-style file with coordinates for d1blua_.
(The format of our PDB-style files is described here.)

Timeline for d1blua_: