| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins) contains two 4Fe-4S clusters |
| Protein Ferredoxin II [54864] (5 species) |
| Species Chromatium vinosum [TaxId:1049] [54869] (1 PDB entry) |
| Domain d1blua_: 1blu A: [38948] complexed with sf4 |
PDB Entry: 1blu (more details), 2.1 Å
SCOPe Domain Sequences for d1blua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]}
almitdecincdvcepecpngaisqgdetyviepslctecvghyetsqcvevcpvdciik
dpsheetedelrakyeritg
Timeline for d1blua_: