PDB entry 1blu

View 1blu on RCSB PDB site
Description: structure of the 2[4fe-4s] ferredoxin from chromatium vinosum
Class: electron transport
Keywords: electron transport, ferredoxin
Deposited on 1996-04-16, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Allochromatium vinosum [TaxId:1049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1blua_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bluA (A:)
    almitdecincdvcepecpngaisqgdetyviepslctecvghyetsqcvevcpvdciik
    dpsheetedelrakyeritgeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bluA (A:)
    almitdecincdvcepecpngaisqgdetyviepslctecvghyetsqcvevcpvdciik
    dpsheetedelrakyeritg