| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
| Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
| Species Thermus aquaticus [TaxId:271] [53121] (29 PDB entries) |
| Domain d1bgxt3: 1bgx T:290-422 [33699] Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt1, d1bgxt2, d1bgxt4 protein/DNA complex |
PDB Entry: 1bgx (more details), 2.3 Å
SCOPe Domain Sequences for d1bgxt3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bgxt3 c.55.3.5 (T:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg
Timeline for d1bgxt3:
View in 3DDomains from other chains: (mouse over for more information) d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2 |