Lineage for d1bgxt2 (1bgx T:1-173)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169006Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2169007Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2169068Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 2169069Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)
  7. 2169070Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries)
  8. 2169072Domain d1bgxt2: 1bgx T:1-173 [33353]
    Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt1, d1bgxt3, d1bgxt4
    protein/DNA complex

Details for d1bgxt2

PDB Entry: 1bgx (more details), 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab
PDB Compounds: (T:) taq DNA polymerase

SCOPe Domain Sequences for d1bgxt2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgxt2 c.120.1.2 (T:1-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
mrgmlplfepkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgd
avivvfdakapsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeadd
vlaslakkaekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

SCOPe Domain Coordinates for d1bgxt2:

Click to download the PDB-style file with coordinates for d1bgxt2.
(The format of our PDB-style files is described here.)

Timeline for d1bgxt2: