| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology |
| Protein Benzoylformate decarboxylase [88731] (1 species) |
| Species Pseudomonas putida [TaxId:303] [88732] (5 PDB entries) |
| Domain d1bfd_2: 1bfd 2-181 [31801] Other proteins in same PDB: d1bfd_1, d1bfd_3 complexed with ca, mg, tpp |
PDB Entry: 1bfd (more details), 1.6 Å
SCOP Domain Sequences for d1bfd_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfd_2 c.36.1.5 (2-181) Benzoylformate decarboxylase {Pseudomonas putida}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
Timeline for d1bfd_2: