Lineage for d1bfda2 (1bfd A:2-181)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694612Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 694636Protein Benzoylformate decarboxylase [88731] (1 species)
  7. 694637Species Pseudomonas putida [TaxId:303] [88732] (8 PDB entries)
  8. 694644Domain d1bfda2: 1bfd A:2-181 [31801]
    Other proteins in same PDB: d1bfda1, d1bfda3
    complexed with ca, mg, tpp

Details for d1bfda2

PDB Entry: 1bfd (more details), 1.6 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOP Domain Sequences for d1bfda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfda2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOP Domain Coordinates for d1bfda2:

Click to download the PDB-style file with coordinates for d1bfda2.
(The format of our PDB-style files is described here.)

Timeline for d1bfda2: