Lineage for d1bfd_2 (1bfd 2-181)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) 
Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (3 proteins) Protein Benzoylformate decarboxylase [52526] (1 species) Species Pseudomonas putida [TaxId:303] [52527] (1 PDB entry) 
Domain d1bfd_2: 1bfd 2-181 [31801]
Other proteins in same PDB: d1bfd_1
Details for d1bfd_2
PDB Entry: 1bfd (more details), 1.6 Å
PDB Description: benzoylformate decarboxylase from pseudomonas putida
SCOP Domain Sequences for d1bfd_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfd_2 c.36.1.1 (2-181) Benzoylformate decarboxylase {Pseudomonas putida}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
SCOP Domain Coordinates for d1bfd_2:
Click to download the PDB-style file with coordinates for d1bfd_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bfd_2:
- d1bfd_2 appears in SCOP 1.57
- d1bfd_2 appears in the current release, SCOPe 2.08, called d1bfda2
View in 3D
