Lineage for d1b7ba_ (1b7b A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1181576Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1181577Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1181578Family c.73.1.1: Carbamate kinase [53634] (1 protein)
  6. 1181579Protein Carbamate kinase [53635] (3 species)
  7. 1181588Species Enterococcus faecium [TaxId:1352] [53636] (1 PDB entry)
  8. 1181589Domain d1b7ba_: 1b7b A: [34963]
    complexed with so4

Details for d1b7ba_

PDB Entry: 1b7b (more details), 2.8 Å

PDB Description: Carbamate kinase from Enterococcus faecalis
PDB Compounds: (A:) carbamate kinase

SCOPe Domain Sequences for d1b7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]}
gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
eivgtvv

SCOPe Domain Coordinates for d1b7ba_:

Click to download the PDB-style file with coordinates for d1b7ba_.
(The format of our PDB-style files is described here.)

Timeline for d1b7ba_: