Lineage for d1b7ba_ (1b7b A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27159Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
  4. 27160Superfamily c.73.1: Carbamate kinase-like [53633] (1 family) (S)
  5. 27161Family c.73.1.1: Carbamate kinase-like [53634] (1 protein)
  6. 27162Protein Carbamate kinase [53635] (2 species)
  7. 27163Species Enterococcus faecium [TaxId:1352] [53636] (1 PDB entry)
  8. 27164Domain d1b7ba_: 1b7b A: [34963]

Details for d1b7ba_

PDB Entry: 1b7b (more details), 2.8 Å

PDB Description: Carbamate kinase from Enterococcus faecalis

SCOP Domain Sequences for d1b7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium}
gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
eivgtvv

SCOP Domain Coordinates for d1b7ba_:

Click to download the PDB-style file with coordinates for d1b7ba_.
(The format of our PDB-style files is described here.)

Timeline for d1b7ba_: