Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein CD94 [56440] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56441] (4 PDB entries) |
Domain d1b6ea_: 1b6e A: [42326] |
PDB Entry: 1b6e (more details), 2.6 Å
SCOPe Domain Sequences for d1b6ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6ea_ d.169.1.1 (A:) CD94 {Human (Homo sapiens) [TaxId: 9606]} cscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfywig lsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickqql i
Timeline for d1b6ea_: