Lineage for d1b6ea_ (1b6e A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1940581Protein CD94 [56440] (1 species)
  7. 1940582Species Human (Homo sapiens) [TaxId:9606] [56441] (4 PDB entries)
  8. 1940585Domain d1b6ea_: 1b6e A: [42326]

Details for d1b6ea_

PDB Entry: 1b6e (more details), 2.6 Å

PDB Description: human cd94
PDB Compounds: (A:) cd94

SCOPe Domain Sequences for d1b6ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ea_ d.169.1.1 (A:) CD94 {Human (Homo sapiens) [TaxId: 9606]}
cscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfywig
lsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickqql
i

SCOPe Domain Coordinates for d1b6ea_:

Click to download the PDB-style file with coordinates for d1b6ea_.
(The format of our PDB-style files is described here.)

Timeline for d1b6ea_: