Lineage for d1b56a_ (1b56 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414571Protein Epidermal fatty acid binding protein [50854] (1 species)
  7. 2414572Species Human (Homo sapiens) [TaxId:9606] [50855] (6 PDB entries)
  8. 2414575Domain d1b56a_: 1b56 A: [27183]
    complexed with plm

Details for d1b56a_

PDB Entry: 1b56 (more details), 2.05 Å

PDB Description: human recombinant epidermal fatty acid binding protein
PDB Compounds: (A:) fatty acid binding protein

SCOPe Domain Sequences for d1b56a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b56a_ b.60.1.2 (A:) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
tvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestlkt
tqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvecvm
nnvtctriyekve

SCOPe Domain Coordinates for d1b56a_:

Click to download the PDB-style file with coordinates for d1b56a_.
(The format of our PDB-style files is described here.)

Timeline for d1b56a_: