SCOPe 2.08: Domain d1b56a_: 1b56 A:

Lineage for d1b56a_ (1b56 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Epidermal fatty acid binding protein [50854] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50855] (6 PDB entries)

8. Domain d1b56a_: 1b56 A: [27183]
   complexed with plm

Details for d1b56a_

PDB Entry: 1b56, 2.05 Å

PDB Description: human recombinant epidermal fatty acid binding protein

PDB Compounds: (A:) fatty acid binding protein

SCOPe Domain Sequences for d1b56a_:

Sequence; same for both SEQRES and ATOM records:

>d1b56a_ b.60.1.2 (A:) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
tvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestlkt
tqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvecvm
nnvtctriyekve

Timeline for d1b56a_:

• d1b56a_ first appeared (with stable ids) in SCOP 1.55, called d1b56__
  
• d1b56a_ appears in SCOPe 2.07