Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily) beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432 |
Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (1 family) |
Family d.35.1.1: Heme-binding protein A (HasA) [54622] (2 proteins) |
Protein Heme-binding protein A (HasA) [54623] (1 species) |
Species Serratia marcescens [TaxId:615] [54624] (6 PDB entries) |
Domain d1b2va_: 1b2v A: [38532] complexed with ca, hem |
PDB Entry: 1b2v (more details), 1.9 Å
SCOPe Domain Sequences for d1b2va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b2va_ d.35.1.1 (A:) Heme-binding protein A (HasA) {Serratia marcescens [TaxId: 615]} afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata
Timeline for d1b2va_: