Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species) the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated |
Species Escherichia coli [TaxId:562] [51896] (1 PDB entry) |
Domain d1b0aa1: 1b0a A:123-288 [30286] Other proteins in same PDB: d1b0aa2 |
PDB Entry: 1b0a (more details), 2.56 Å
SCOPe Domain Sequences for d1b0aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvvg dvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdpqde
Timeline for d1b0aa1: