Lineage for d1b0aa1 (1b0a A:123-288)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins) 
Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species) 
Species Escherichia coli [TaxId:562] [51896] (1 PDB entry) 
Domain d1b0aa1: 1b0a A:123-288 [30286]
Other proteins in same PDB: d1b0aa2
Details for d1b0aa1
PDB Entry: 1b0a (more details), 2.56 Å
PDB Description: 5,10, methylene-tetrahydropholate dehydrogenase/cyclohydrolase from e coli.
SCOP Domain Sequences for d1b0aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli}
fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla
gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvvg
dvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdpqde
SCOP Domain Coordinates for d1b0aa1:
Click to download the PDB-style file with coordinates for d1b0aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b0aa1:
- d1b0aa1 appears in SCOP 1.57
- d1b0aa1 appears in the current release, SCOPe 2.08
View in 3D
