Lineage for d1auua_ (1auu A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 797786Superfamily b.35.2: SacY-like RNA-binding domain [50151] (1 family) (S)
  5. 797787Family b.35.2.1: BglG-like antiterminator proteins [50152] (2 proteins)
  6. 797792Protein SacY [50153] (1 species)
  7. 797793Species Bacillus subtilis [TaxId:1423] [50154] (1 PDB entry)
  8. 797794Domain d1auua_: 1auu A: [24769]

Details for d1auua_

PDB Entry: 1auu (more details)

PDB Description: solution structure of the rna-binding domain of the antiterminator protein sacy, nmr, 10 structures
PDB Compounds: (A:) sacy

SCOP Domain Sequences for d1auua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auua_ b.35.2.1 (A:) SacY {Bacillus subtilis [TaxId: 1423]}
mkikrilnhnaivvkdqneekillgagiafnkkkndivdpskiektfirkdtpdy

SCOP Domain Coordinates for d1auua_:

Click to download the PDB-style file with coordinates for d1auua_.
(The format of our PDB-style files is described here.)

Timeline for d1auua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1auub_