| Class b: All beta proteins [48724] (180 folds) |
| Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.2: SacY-like RNA-binding domain [50151] (1 family) ![]() automatically mapped to Pfam PF03123 |
| Family b.35.2.1: BglG-like antiterminator proteins [50152] (2 proteins) |
| Protein SacY [50153] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [50154] (1 PDB entry) |
| Domain d1auua_: 1auu A: [24769] |
PDB Entry: 1auu (more details)
SCOPe Domain Sequences for d1auua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auua_ b.35.2.1 (A:) SacY {Bacillus subtilis [TaxId: 1423]}
mkikrilnhnaivvkdqneekillgagiafnkkkndivdpskiektfirkdtpdy
Timeline for d1auua_: