PDB entry 1auu

View 1auu on RCSB PDB site
Description: solution structure of the RNA-binding domain of the antiterminator protein sacy, nmr, 10 structures
Class: transcription regulation
Keywords: antitermination, RNA binding domain, transcription regulation
Deposited on 1997-09-02, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sacy
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15401 (0-54)
  Domains in SCOPe 2.08: d1auua_
• Chain 'B':
  Compound: sacy
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15401 (0-54)
  Domains in SCOPe 2.08: d1auub_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1auuA (A:)
  mkikrilnhnaivvkdqneekillgagiafnkkkndivdpskiektfirkdtpdy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1auuB (B:)
  mkikrilnhnaivvkdqneekillgagiafnkkkndivdpskiektfirkdtpdy