PDB entry 1auu

View 1auu on RCSB PDB site
Description: solution structure of the RNA-binding domain of the antiterminator protein sacy, nmr, 10 structures
Class: transcription regulation
Keywords: antitermination, RNA binding domain, transcription regulation
Deposited on 1997-09-02, released 1997-11-12
The last revision prior to the SCOP 1.75 freeze date was dated 1997-11-12, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sacy
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1auua_
  • Chain 'B':
    Compound: sacy
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1auub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1auuA (A:)
    mkikrilnhnaivvkdqneekillgagiafnkkkndivdpskiektfirkdtpdy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1auuB (B:)
    mkikrilnhnaivvkdqneekillgagiafnkkkndivdpskiektfirkdtpdy