| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins) |
| Protein Carboxylesterase [53548] (2 species) |
| Species Pseudomonas fluorescens [TaxId:294] [53549] (2 PDB entries) |
| Domain d1auoa_: 1auo A: [34716] |
PDB Entry: 1auo (more details), 1.8 Å
SCOPe Domain Sequences for d1auoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}
mteplilqpakpadacviwlhglgadrydfmpvaealqesllttrfvlpqaptrpvting
gyempswydikamsparsisleelevsakmvtdlieaqkrtgidasriflagfsqggavv
fhtafinwqgplggvialstyaptfgdelelsasqqripalclhgqyddvvqnamgrsaf
ehlksrgvtvtwqeypmghevlpqeihdigawlaarlg
Timeline for d1auoa_: