PDB entry 1auo

View 1auo on RCSB PDB site
Description: carboxylesterase from pseudomonas fluorescens
Class: hydrolase
Keywords: hydrolase
Deposited on 1997-09-01, released 1998-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxylesterase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1auoa_
  • Chain 'B':
    Compound: carboxylesterase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1auob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1auoA (A:)
    mteplilqpakpadacviwlhglgadrydfmpvaealqesllttrfvlpqaptrpvting
    gyempswydikamsparsisleelevsakmvtdlieaqkrtgidasriflagfsqggavv
    fhtafinwqgplggvialstyaptfgdelelsasqqripalclhgqyddvvqnamgrsaf
    ehlksrgvtvtwqeypmghevlpqeihdigawlaarlg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1auoB (B:)
    mteplilqpakpadacviwlhglgadrydfmpvaealqesllttrfvlpqaptrpvting
    gyempswydikamsparsisleelevsakmvtdlieaqkrtgidasriflagfsqggavv
    fhtafinwqgplggvialstyaptfgdelelsasqqripalclhgqyddvvqnamgrsaf
    ehlksrgvtvtwqeypmghevlpqeihdigawlaarlg