Lineage for d1auob_ (1auo B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900680Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)
  6. 2900685Protein Carboxylesterase [53548] (2 species)
  7. 2900690Species Pseudomonas fluorescens [TaxId:294] [53549] (2 PDB entries)
  8. 2900692Domain d1auob_: 1auo B: [34717]

Details for d1auob_

PDB Entry: 1auo (more details), 1.8 Å

PDB Description: carboxylesterase from pseudomonas fluorescens
PDB Compounds: (B:) carboxylesterase

SCOPe Domain Sequences for d1auob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auob_ c.69.1.14 (B:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}
mteplilqpakpadacviwlhglgadrydfmpvaealqesllttrfvlpqaptrpvting
gyempswydikamsparsisleelevsakmvtdlieaqkrtgidasriflagfsqggavv
fhtafinwqgplggvialstyaptfgdelelsasqqripalclhgqyddvvqnamgrsaf
ehlksrgvtvtwqeypmghevlpqeihdigawlaarlg

SCOPe Domain Coordinates for d1auob_:

Click to download the PDB-style file with coordinates for d1auob_.
(The format of our PDB-style files is described here.)

Timeline for d1auob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1auoa_