Lineage for d1aiqa_ (1aiq A:)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) Protein Thymidylate synthase [55833] (7 species) Species Escherichia coli [TaxId:562] [55834] (65 PDB entries) 
Domain d1aiqa_: 1aiq A: [40967]
complexed with cb3, ump; mutant
Details for d1aiqa_
PDB Entry: 1aiq (more details), 2.2 Å
PDB Description: crystal structure of thymidylate synthase r126e mutant
PDB Compounds: (A:) Thymidylate synthaseSCOPe Domain Sequences for d1aiqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aiqa_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdseriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOPe Domain Coordinates for d1aiqa_:
Click to download the PDB-style file with coordinates for d1aiqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aiqa_:
- d1aiqa_ first appeared (with stable ids) in SCOP 1.55
- d1aiqa_ appears in SCOPe 2.01
- d1aiqa_ appears in SCOPe 2.03
- d1aiqa_ appears in the current release, SCOPe 2.08
View in 3D
