Lineage for d1ahk__ (1ahk -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552323Family b.1.18.7: ML domain [81287] (2 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
  6. 552327Protein Major mite allergen [49256] (2 species)
    contains additional N-terminal strand
  7. 552328Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (3 PDB entries)
  8. 552332Domain d1ahk__: 1ahk - [21945]

Details for d1ahk__

PDB Entry: 1ahk (more details)

PDB Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, minimized average structure

SCOP Domain Sequences for d1ahk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahk__ b.1.18.7 (-) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

SCOP Domain Coordinates for d1ahk__:

Click to download the PDB-style file with coordinates for d1ahk__.
(The format of our PDB-style files is described here.)

Timeline for d1ahk__: