PDB entry 1ahk

View 1ahk on RCSB PDB site
Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, minimized average structure
Deposited on 1997-04-07, released 1998-04-08
The last revision prior to the SCOP 1.71 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1ahk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ahk_ (-)
    dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
    leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
    iathgkird