![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.7: ML domain [81287] (2 proteins) implicated in lipid recognition, particularly in the recognition of pathogen related products |
![]() | Protein Major mite allergen [49256] (2 species) contains additional N-terminal strand |
![]() | Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries) |
![]() | Domain d1ahka_: 1ahk A: [21945] |
PDB Entry: 1ahk (more details)
SCOP Domain Sequences for d1ahka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahka_ b.1.18.7 (A:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]} dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca iathgkird
Timeline for d1ahka_: