Lineage for d1a8va1 (1a8v A:-1-47)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926236Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 926275Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) (S)
  5. 926276Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 926277Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 926278Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)
    Uniprot P03002
  8. 926280Domain d1a8va1: 1a8v A:-1-47 [64712]
    Other proteins in same PDB: d1a8va2, d1a8vb2
    complexed with cu

Details for d1a8va1

PDB Entry: 1a8v (more details), 2 Å

PDB Description: structure of the rna-binding domain of the rho transcription terminator
PDB Compounds: (A:) transcription termination factor rho

SCOPe Domain Sequences for d1a8va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8va1 a.140.3.1 (A:-1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOPe Domain Coordinates for d1a8va1:

Click to download the PDB-style file with coordinates for d1a8va1.
(The format of our PDB-style files is described here.)

Timeline for d1a8va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8va2