Lineage for d1a1w__ (1a1w -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540616Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 540617Superfamily a.77.1: DEATH domain [47986] (4 families) (S)
  5. 540672Family a.77.1.4: DEATH effector domain, DED [81388] (2 proteins)
  6. 540673Protein FADD (Mort1) [81387] (1 species)
    contains two domains of this superfamily: DED and DD, in this order
  7. 540674Species Human (Homo sapiens) [TaxId:9606] [81386] (2 PDB entries)
  8. 540675Domain d1a1w__: 1a1w - [18425]
    mutant

Details for d1a1w__

PDB Entry: 1a1w (more details)

PDB Description: fadd death effector domain, f25y mutant, nmr minimized average structure

SCOP Domain Sequences for d1a1w__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1w__ a.77.1.4 (-) FADD (Mort1) {Human (Homo sapiens)}
mdpflvllhsvssslssseltelkylclgrvgkrklervqsgldlfsmlleqndlepght
ellrellaslrrhdllrrvddfe

SCOP Domain Coordinates for d1a1w__:

Click to download the PDB-style file with coordinates for d1a1w__.
(The format of our PDB-style files is described here.)

Timeline for d1a1w__: