Lineage for d1a1wa_ (1a1w A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2719039Family a.77.1.4: DEATH effector domain, DED [81388] (2 proteins)
  6. 2719040Protein FADD (Mort1) [81387] (1 species)
    contains two domains of this superfamily: DED and DD, in this order
  7. 2719041Species Human (Homo sapiens) [TaxId:9606] [81386] (3 PDB entries)
  8. 2719043Domain d1a1wa_: 1a1w A: [18425]
    mutant

Details for d1a1wa_

PDB Entry: 1a1w (more details)

PDB Description: fadd death effector domain, f25y mutant, nmr minimized average structure
PDB Compounds: (A:) fadd protein

SCOPe Domain Sequences for d1a1wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1wa_ a.77.1.4 (A:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
mdpflvllhsvssslssseltelkylclgrvgkrklervqsgldlfsmlleqndlepght
ellrellaslrrhdllrrvddfe

SCOPe Domain Coordinates for d1a1wa_:

Click to download the PDB-style file with coordinates for d1a1wa_.
(The format of our PDB-style files is described here.)

Timeline for d1a1wa_: